PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000171.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 1006aa    MW: 111913 Da    PI: 6.8092
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000171.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.12e-29603654152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek+i+l+ l++yF++++kdAAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  Itr_sc000171.1_g00004.1 603 AEKTITLQILQQYFAGSLKDAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 654
                              589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.518593674IPR003035RWP-RK domain
PfamPF020423.2E-26606654IPR003035RWP-RK domain
SMARTSM006664.5E-23814899IPR000270PB1 domain
PROSITE profilePS5174523.418814893IPR000270PB1 domain
SuperFamilySSF542771.96E-22815899No hitNo description
PfamPF005646.5E-19816892IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.4E-23816892No hitNo description
CDDcd064073.00E-42816892No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1006 aa     Download sequence    Send to blast
MDESVFPSSI VLNTTSDSSF MDLDDLLLEG CWLETTDGSE FFQHSPFNPN ALFEPSYLLP  60
QLEPNNGELI EGVSKESEGV SKESEVERKK SSLPENLSAS QYQGVQCFGQ NDSNAVCSSG  120
LVESPELSRR WWIGPKATTS VMDRLIQALG YIKDFSRDKD MLIQIWVPVN RDGRRVLVTG  180
DQPFQLDLKC PRLAHYRDIS IDYEFPVEED SQENVGLPGR VFLGKVPEWT PDVQLFKREE  240
YPRVGHAQRY DVRGTFAVPV FDQGSRTCLG VIEVVLTTQK VKYRHELDSV CKALEEVDLR  300
GSKISNVRNT KTCDSYQVVL PEILEVLKSA CATHKLPLAQ TWVPCVQQGK EGLRHSDENL  360
LRCVSTVDSA CYIADPRIQG FHEACSEHHL LKGLGVVGRA FMTNQPCFSA DITSFSKTEY  420
PLSHYARIFS LQAAVAIRLR STCTGSTDFV LEFFLPRDCK SPEEHKRMLT SLSIIIQNVC  480
QTLRVVTEQE LEEEATSLSS KAAKNSDIRI NKEVPNLKYN SSVGPCEEGC SWTSSPTLVQ  540
ESCMTASAFQ NEKASELLYK RLPEFRQQLP EFVSGSGLSF DSTSGEGSAQ NLGRAGDKKR  600
MKAEKTITLQ ILQQYFAGSL KDAAKSLGVC PTTLKRICRQ HGIKRWPSRK IKKVGHSLQK  660
IRRVIDSVQG ASGALQIETF YSNFPELASP NVSRSNPTSD EQHPSLLNRQ HEGENVCPNG  720
SASKSPSSSC SQSSSSSQCC SSGTQPSPCT LHAAAPETAA VREESVNGVV KRVKSDAELL  780
VSNDGLTTTL PRSQSHASLS EHPKSECLPP TKDGPRVKVT FGEEKIRFRL QNHWGYQDLV  840
KEIARRFGID DPRGFQLKYL DDDLEWVLLT CDADLEECID VCRASQNQTI RLAFLCNSQH  900
QFGSSLGTKN PSGIRACIWG SLHLTSRRME SVACFGVIPL FFDAHCRLGR VSLSLVKNVC  960
PPVWSLSSLP CGPSLYGPLC VHPELRYLWR PSFRFREGPI PSLFSP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506272.10.0PREDICTED: protein NLP5-like
TrEMBLA0A0V0IWK30.0A0A0V0IWK3_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein